Human beta defensin 3 (hBD-3)

140,002475,00

Clear
SKU: GPS 20141 Category:

Description

Also known as: Beta-defensin 3; BD-3; DEFB-3; HBD3; hBD-3; Defensin, beta 103; Defensin-like protein
AA sequence: H-GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK-OH
Disulfide bridges: C11-C40; C18-C33; C23-C41
Length (aa): 45
Formula: C216H371N75O59S6
Molecular weight: 5155.22 g/mol
Appearance: White lyophilized solid
Solubility: water and saline buffer
UniProt: P81534
Source: Synthetic
Purity: > 95 %

Additional information

Weight [mg]

0.1, 0.5, 1, 5, 10