Human beta defensin 2 (hBD-2)

140,002475,00

Clear
SKU: GPS 20140 Category:

Description

Also known as: Beta-defensin 4A; BD-2; hBD-2; Defensin, beta 2; Skin-antimicrobial peptide 1; SAP1
AA sequence: H-GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH
Disulfide bridges: C8-C37; C15-C30; C20-C38
Length (aa): 41
Formula: C188H305N55O50S6
Molecular weight: 4328.20 g/mol
Appearance: White lyophilized solid
Solubility: water and saline buffer
UniProt: O15263
Source: Synthetic
Purity: > 95 %

Additional information

Weight [mg]

0.1, 0.5, 1, 10, 5